gopubmed logo
find other proteinsAll proteins
GoPubMed Proteins lists recent and important papers and reviews for proteins. Page last changed on 19 Dec 2016.

Renin 1 structural

Ren, Ren-1, Ren-1c, renin-1
Top mentioned proteins: Renin, Angiotensin II, HAD, CAN, TGR
Papers using Ren antibodies
Neuroptera – grace with lace.
Ren Dong et al., In ZooKeys, 2009
... Gao and Ren 2006).Specimens were examined using a Leica MZ12.5 dissecting microscope; line ...
Gulino Alberto et al., In The Journal of Cell Biology, 1996
... REN sequences were obtained by screening an oligo(dT) and random primed Swiss Webster/NIH mouse 7-d Embryo 5′ Stretch Plus cDNA Library (CLONTECH Laboratories, Inc.) with a 260-bp ...
Papers on Ren
Moderate additive effects of endothelin receptor a blockade in Ren-2 transgenic rats subjected to various types of RAS blockade.
Zicha et al., Praha, Czech Republic. In Life Sci, Feb 2016
We tested whether the addition of ETA blockade to renin-angiotensin system (RAS) blockade would have further effects on principal vasoactive systems contributing to BP maintenance in Ren-2 transgenic rats (TGR).
NADPH oxidase activity and reactive oxygen species production in brain and kidney of adult male hypertensive Ren-2 transgenic rats.
Zicha et al., Praha, Czech Republic. In Physiol Res, Jan 2016
The aim of our present study was to investigate NADPH oxidase-mediated superoxide (O(2)(-)) production and to search for the signs of lipid peroxidation in hypothalamus and medulla oblongata as well as in renal medulla and cortex of hypertensive male rats transgenic for the murine Ren-2 renin gene (Ren-2 TGR) and their age-matched normotensive controls - Hannover Sprague Dawley rats (HanSD).
Liquid-vapor transition on patterned solid surfaces in a shear flow.
Ren et al., Singapore, Singapore. In J Chem Phys, Jan 2016
E, W. Ren, and E. Vanden-Eijnden, Commun.
The prevalence of unique SNPs in the renin-angiotensin system highlights the need for pharmacogenetics in Indigenous Australians.
Scott et al., Newcastle, Australia. In Clin Exp Pharmacol Physiol, Jan 2016
The polymorphisms were angiotensinogen, AGT G-217A (rs5049); AGT G+174A (rs4762); Angiotensin II type 1 receptor, AGTR1 A+1166C (rs5186); angiotensin converting enzyme, ACE A-240T (rs4291), ACE T-93C (rs4292); renin, REN T+1142C (rs5706).
Renin gene rs1464816 polymorphism contributes to chronic kidney disease progression in ADPKD.
Lakkakula et al., Chennai, India. In J Biomed Sci, Dec 2015
The enzyme renin plays a key role in the RAAS cascade and an important role in the development of hypertension and progression of renal disease in ADPKD.
Autosomal dominant tubulointerstitial kidney disease: diagnosis, classification, and management--A KDIGO consensus report.
Devuyst et al., Erlangen, Germany. In Kidney Int, Oct 2015
Rare autosomal dominant tubulointerstitial kidney disease is caused by mutations in the genes encoding uromodulin (UMOD), hepatocyte nuclear factor-1β (HNF1B), renin (REN), and mucin-1 (MUC1).
Oleuropein-Enriched Olive Leaf Extract Affects Calcium Dynamics and Impairs Viability of Malignant Mesothelioma Cells.
Burlando et al., Genova, Italy. In Evid Based Complement Alternat Med, 2014
Effects of the oleuropein-enriched fraction on Ca(2+) dynamics and cell viability were studied in the REN mesothelioma cell line, using fura-2 microspectrofluorimetry and MTT assay, respectively.
Control of renin [corrected] gene expression.
Pan et al., Buffalo, United States. In Pflugers Arch, 2013
Initial studies using the mouse As4.1 cell line, which has many characteristics of the renin-expressing juxtaglomerular cells of the kidney, have identified a proximal promoter region (-197 to -50 bp) and an enhancer (-2,866 to -2,625 bp) upstream of the Ren-1(c) gene, which are critical for renin gene expression.
Chicken ovalbumin upstream promoter transcription factor II regulates renin gene expression.
Todorov et al., Dresden, Germany. In J Biol Chem, 2012
Data show that COUP-TFII is involved in the control of renin gene expression.
Role of blood pressure in mediating the influence of salt intake on renin expression in the kidney.
Kurtz et al., Regensburg, Germany. In Am J Physiol Renal Physiol, 2012
Changes in preglomerular blood pressure may be an important mediator of the influence of salt intake on the number and distribution of renin-producing cells in the kidney.
Regulation of mouse-renin gene by apurinic/apyrimidinic-endonuclease 1 (APE1/Ref-1) via recruitment of histone deacetylase 1 corepressor complex.
Bhakat et al., Galveston, United States. In J Hypertens, 2012
the mouse-renin gene is regulated by apurinic/apyrimidinic-endonuclease 1 (APE1/Ref-1) via recruitment of histone deacetylase 1 corepressor complex
Regulation of renin expression by the orphan nuclear receptors Nr2f2 and Nr2f6.
Sigmund et al., Iowa City, United States. In Am J Physiol Renal Physiol, 2012
It was concluded that both Nr2f2 and Nr2f6 negatively regulate renin promoter activity, but may do so by divergent mechanisms.
(68)Ga-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC
Shan, Bethesda, United States. In Unknown Journal, 2011
The (68)Ga-labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA)-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 (MUT-DS) conjugate with a disulfide bridge between the two homocysteines, abbreviated as (68)Ga-DOTA-MUT-DS, is a 2-helix affibody derivative that was synthesized by Ren et al. for positron emission tomography (PET) of HER2-expressing tumors (1).
(111)In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC
Shan, Bethesda, United States. In Unknown Journal, 2011
The (111)In-labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA)-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 (MUT-DS) conjugate with a disulfide bridge between the two homocysteines, abbreviated as (111)In-DOTA-MUT-DS, is a 2-helix affibody derivative that was synthesized by Ren et al. for single-photon emission computed tomography (SPECT) of HER2-expressing tumors (1).
(64)Cu-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC
Shan, Bethesda, United States. In Unknown Journal, 2011
The (64)Cu-labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA)-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 (MUT-DS) conjugate with a disulfide bridge between the two homocysteines, abbreviated as (64)Cu-DOTA-MUT-DS, is a 2-helix affibody derivative that was synthesized by Ren et al. for positron emission tomography (PET) of HER2-expressing tumors (1).
Vesicle-associated membrane protein-2 (VAMP2) mediates cAMP-stimulated renin release in mouse juxtaglomerular cells.
Carretero et al., Detroit, United States. In J Biol Chem, 2011
VAMP2 and VAMP3 are expressed in JG cells, but only VAMP2 is targeted to renin-containing granules and mediates the stimulatory effect of cAMP on renin exocytosis.
Histone deacetylase and Cullin3-REN(KCTD11) ubiquitin ligase interplay regulates Hedgehog signalling through Gli acetylation.
Gulino et al., Roma, Italy. In Nat Cell Biol, 2010
Results show negative regulation of HDAC1 by a Cul3-REN E3 ubiquitin ligase complex.
A tethering complex recruits SNAREs and grabs vesicles.
Jahn et al., Göttingen, Germany. In Cell, 2010
Ren et al. (2009) now provide evidence that the yeast Dsl1 complex tethers vesicles to the endoplasmic reticulum (ER) by binding ER SNARE proteins at its base and capturing vesicles using a loop region that extends 20 nm from the ER membrane.
Genetic determinants of diastolic and pulse pressure map to different loci in Lyon hypertensive rats.
Sassard et al., Paris, France. In Nat Genet, 1993
Significant linkage was established between diastolic blood pressure and a microsatellite marker of the renin gene (REN) on rat chromosome 13, and between pulse pressure and the carboxypeptidase B gene (CPB) on chromosome 2.
Fulminant hypertension in transgenic rats harbouring the mouse Ren-2 gene.
Ganten et al., Heidelberg, Germany. In Nature, 1990
Here we describe the introduction of the mouse Ren-2 renin gene into the genome of the rat and demonstrate that expression of this gene causes severe hypertension.
share on facebooktweetadd +1mail to friends