gopubmed logo
find other proteinsAll proteins
GoPubMed Proteins lists recent and important papers and reviews for proteins. Page last changed on 19 Aug 2016.

Cathelicidin antimicrobial peptide

Cramp, LL-37
This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. The encoded protein has several functions in addition to antimicrobial activity, including cell chemotaxis, immune mediator induction and inflammatory response regulation. [provided by RefSeq, Aug 2011] (from NCBI)
Top mentioned proteins: CAN, Defensin, HAD, V1a, ACID
Papers using Cramp antibodies
Novel families of antimicrobial peptides with multiple functions from skin of Xizang plateau frog, Nanorana parkeri.
Proost Paul, In PLoS ONE, 2009
... Two cathelicidins (snake cathelicidin-BF, KFFRKLKKSVKKRAKEFFKKPRVIGVSIPF, and human cathelicidin, LL-37, [LL-37, 37 aa]) were synthesized by GL Biochem (Shanghai) Ltd ...
Comparison of alamar blue and MTT assays for high through-put screening.
Bush Ashley I., In PLoS ONE, 2003
... Scrambled LL-37 peptide was from AnaSpec (San Jose, CA) ...
The mouse ear inflammatory response to topical arachidonic acid.
Soyer H. Peter, In PLoS ONE, 1983
... Rabbit polyclonal IgG antibody to LL-37 (Cat# sc-50423) was from Santa Cruz Biotechnology (Santa Cruz, CA), and ...
Papers on Cramp
Telomeric G-quadruplex-forming DNA fragments induce TLR9-mediated and LL-37-regulated invasion in breast cancer cells in vitro.
Selander et al., Birmingham, United States. In Breast Cancer Res Treat, Feb 2016
Furthermore, complexing with LL-37, a cathelicidin-peptide present in breast cancers, increased 9-mer hairpin and G-quadruplex DNA uptake into the cancer cells.
Beyond anti-microbial properties: The role of cathelicidin in allergic rhinitis.
Cakir et al., İstanbul, Turkey. In Allergol Immunopathol (madr), Feb 2016
We measured levels of the LL-37 peptide in the nasal fluids of children with allergic rhinitis (AR) and investigated the possible role of this peptide in the pathogenesis of AR.
The Modulatory Effect of TLR2 on LL-37-induced Human Mast Cells Activation.
Yu et al., Shenzhen, China. In Biochem Biophys Res Commun, Feb 2016
UNASSIGNED: The sole and endogenous anti-microbial peptide LL-37 is a significant effector molecule in the innate host defense system.
Single-cell, time-resolved study of the effects of the antimicrobial peptide alamethicin on Bacillus subtilis.
Weisshaar et al., Madison, United States. In Biochim Biophys Acta, Feb 2016
We contrast the effects of alamethicin and the human cathelicidin LL-37 on B. subtilis.
Antimicrobial cathelicidin peptide LL-37 inhibits the pyroptosis of macrophages and improves the survival of polybacterial septic mice.
Nagaoka et al., Tokyo, Japan. In Int Immunol, Feb 2016
Thus, in this study, we further evaluated the effect of LL-37 on pyroptosis in vivo using a cecal ligation and puncture (CLP) septic model.
Diagnosis of Periprosthetic Infection: Novel Developments.
Parvizi et al., Seattle, United States. In Orthop Clin North Am, Jan 2016
Synovial CRP, α-defensin, human β-defensin-2 and -3, leukocyte esterase, and cathelicidin LL-37 biomarkers hold promise for the diagnosis of PJI.
The role of altered cutaneous immune responses in the induction and persistence of rosacea.
Kavanagh et al., Ireland. In J Dermatol Sci, Jan 2016
Alterations in the immune response include elevated levels of LL-37 in rosacea skin, increased expression of TLR-2 and increased amounts of vitamin D3 in epidermal tissue.
Mitochondrial DNA-LL-37 Complex Promotes Atherosclerosis by Escaping from Autophagic Recognition.
Lai et al., Kunming, China. In Immunity, Jan 2016
Mitochondrial DNA (mtDNA) and human antimicrobial peptide LL-37 (Cramp in mice) are involved in atherosclerosis.
Inflammatory Diseases of the Lung Induced by Conventional Cigarette Smoke: A Review.
Hwang et al., In Chest, Dec 2015
In particular, metalloproteases 9 and 12, surfactant protein D, antimicrobial peptides (LL-37 and human β defensin 2), and IL-1, IL-6, IL-8, and IL-17 have been found in higher quantities in the lungs of smokers with ongoing inflammation.
Unique features of human cathelicidin LL-37.
Krupa et al., Częstochowa, Poland. In Biofactors, Oct 2015
This review intends to provide a brief overview of the expression, structure, properties and function of human cathelicidin LL-37 which may be a therapeutic agent against a variety of bacterial and viral diseases, cancers, and hard-to-heal wounds.
Pancreatic β-Cells Limit Autoimmune Diabetes via an Immunoregulatory Antimicrobial Peptide Expressed under the Influence of the Gut Microbiota.
Diana et al., Wuxi, China. In Immunity, Sep 2015
Here, we found that insulin-secreting β-cells produced the cathelicidin related antimicrobial peptide (CRAMP) and that this production was defective in non-obese diabetic (NOD) mice.
Activation of HIF-1α and LL-37 by commensal bacteria inhibits Candida albicans colonization.
Koh et al., Dallas, United States. In Nat Med, Jul 2015
Using Bacteroides thetaiotamicron as a model organism, we find that hypoxia-inducible factor-1α (HIF-1α), a transcription factor important for activating innate immune effectors, and the antimicrobial peptide LL-37 (CRAMP in mice) are key determinants of C. albicans colonization resistance.
The Human Cathelicidin Antimicrobial Peptide LL-37 and Mimics are Potential Anticancer Drugs.
Isogai et al., Sendai, Japan. In Front Oncol, 2014
The human cathelicidin, LL-37, has a net positive charge and is amphiphilic, and can eliminate pathogenic microbes directly via electrostatic attraction toward negatively charged bacterial membranes.
Crosstalk between neutrophils, B-1a cells and plasmacytoid dendritic cells initiates autoimmune diabetes.
Lehuen et al., Paris, France. In Nat Med, 2013
IgGs activate neutrophils to release DNA-binding cathelicidin-related antimicrobial peptide (CRAMP), which binds self DNA.
KLF5 and hhLIM cooperatively promote proliferation of vascular smooth muscle cells.
Zheng et al., Shijiazhuang, China. In Mol Cell Biochem, 2012
KLF5 reverses hhLIM function from anti-proliferation to pro-proliferation through its interaction with hhLIM on the cyclin E promoter.
Cathelicidin-related antimicrobial peptide is required for effective lung mucosal immunity in Gram-negative bacterial pneumonia.
Standiford et al., Ann Arbor, United States. In J Immunol, 2012
CRAMP may exert important immunomodulatory effects that regulate lung injury and Gram-negative bacterial dissemination.
Cardiac remodeling is not modulated by overexpression of muscle LIM protein (MLP).
Frey et al., Kiel, Germany. In Basic Res Cardiol, 2012
Cardiac overexpression of muscle LIM protein does not modulate the heart's response to various forms of pathological stress.
Signaling pathways mediating chemokine induction in keratinocytes by cathelicidin LL-37 and flagellin.
Hancock et al., Vancouver, Canada. In J Innate Immun, 2011
These findings established the signaling pathway mediating the chemokine induction activity of LL-37 in primary keratinocytes and the synergistic effect of LL-37 on the cell response to flagellin.
The over expression of cathelicidin peptide LL37 in head and neck squamous cell carcinoma: the peptide marker for the prognosis of cancer.
Dey et al., New Delhi, India. In Cancer Biomark, 2010
Data suggest that cathelicidin peptide LL37 can be an ef fi cient prognostic marker for head and neck squamous cell carcinoma (HNSCC) and a potent therapeutic target against it.
The antimicrobial peptide cathelicidin protects the urinary tract against invasive bacterial infection.
Brauner et al., Stockholm, Sweden. In Nat Med, 2006
Data describe the production and function of the cathelicidin antimicrobial peptides LL-37, its precursor hCAP-18 and its ortholog CRAMP in epithelial cells of human and mouse urinary tract, respectively.
share on facebooktweetadd +1mail to friends